PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_14643_f_2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family MYB
Protein Properties Length: 304aa    MW: 34215.7 Da    PI: 6.0619
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_14643_f_2genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding231.9e-071449148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd +lv +++++G            + R+ k+c++rw +yl
   Neem_14643_f_2 14 KGPWTPEEDIILVSYIQEHG------------LLRCSKSCRLRWTNYL 49
                     79******************............479999******9997 PP

2Myb_DNA-binding45.91.3e-1455100148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T+ E+  ++++ ++lG++ W++Ia++++  Rt++++k++w+++l
   Neem_14643_f_2  55 RGNFTPHEEGMIIHLQALLGNK-WAAIASYLP-QRTDNDIKNYWNTHL 100
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466894.49E-241196IPR009057Homeodomain-like
SMARTSM007174.1E-61351IPR001005SANT/Myb domain
PfamPF002494.2E-61449IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.0E-141556IPR009057Homeodomain-like
PROSITE profilePS5129423.04450104IPR017930Myb domain
SMARTSM007173.5E-1354102IPR001005SANT/Myb domain
PfamPF002495.0E-1355100IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.9E-2557105IPR009057Homeodomain-like
CDDcd001675.49E-957100No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009414Biological Processresponse to water deprivation
GO:0009416Biological Processresponse to light stimulus
GO:0009737Biological Processresponse to abscisic acid
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0010118Biological Processstomatal movement
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 304 aa     Download sequence    Send to blast
MGRPPCCDKV GIKKGPWTPE EDIILVSYIQ EHGLLRCSKS CRLRWTNYLR PGIKRGNFTP  60
HEEGMIIHLQ ALLGNKWAAI ASYLPQRTDN DIKNYWNTHL KKKLKKFQSA FDPHNPQDST  120
TSQFASKTSF SNSERRSLDF TNQTTSNLRL NPGTSYASST ENISRLLEGW MRSSPKNSNS  180
NNNNTPGNLK ARYEEEKSTG AQNIDNNDSV ENSVATATTS VQFYRPKEEQ ESGGDLISNE  240
EFISILSFEN LNNVAWDKSS TGDSTANKGS QNSATNEDNK WLLDESTGQV EEINQIMELS  300
DSIF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C7e-211210425128MYB TRANSFORMING PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00132DAPTransfer from AT1G08810Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1826776e-45AC182677.2 Populus trichocarpa clone Pop1-29G16, complete sequence.
GenBankEF1488276e-45EF148827.1 Populus trichocarpa x Populus deltoides clone WS0138_M09 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006437263.11e-136hypothetical protein CICLE_v10031946mg
SwissprotP813922e-76MYB06_ANTMA; Myb-related protein 306
TrEMBLA0A067DYG11e-136A0A067DYG1_CITSI; Uncharacterized protein
STRINGPOPTR_0013s06390.11e-121(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G08810.11e-84myb domain protein 60